SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2L1K9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2L1K9
Domain Number 1 Region: 5-120
Classification Level Classification E-value
Superfamily Dom34/Pelota N-terminal domain-like 1.05e-25
Family Dom34/Pelota N-terminal domain-like 0.001
Further Details:      
 
Domain Number 2 Region: 239-336
Classification Level Classification E-value
Superfamily L30e-like 0.00000000000016
Family ERF1/Dom34 C-terminal domain-like 0.0079
Further Details:      
 
Domain Number 3 Region: 130-240
Classification Level Classification E-value
Superfamily Translational machinery components 0.0000000000654
Family ERF1/Dom34 middle domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F2L1K9
Sequence length 336
Comment (tr|F2L1K9|F2L1K9_THEU7) Protein pelota homolog {ECO:0000256|HAMAP-Rule:MF_01853, ECO:0000256|SAAS:SAAS01014537} KW=Complete proteome OX=999630 OS=Thermoproteus uzoniensis (strain 768-20). GN=TUZN_0179 OC=Thermoproteaceae; Thermoproteus.
Sequence
MRLSVDRRRRLISVLPEREEDLYFVYLLVDRGDVVRGWTVREYRPEGAKEGERIKVYLAV
RVEALEYHKFRGSLRVRGTVVEVGGDLEGVKGRRHTFDVLPGREIEIEKPDSYPMELVDE
VARLASAALPKILLVSIDGDEAAVAHITALGVEVLGVLENRRPKDAGSDSEEEALGPFFR
EVAKAVEQYRLRLRPDRLVLAGPQLYIEIAAQYIKGDLAPQSAGGLAGVYEFQRGGHFER
YREALGSEAVSEILKLASERPELIAVGLDAVREAASQGRVRTFVVVDEALKERAEEYAEV
LRLVFSTRGSTRIVPAESEAGQMLSAMGGCAAVLRY
Download sequence
Identical sequences F2L1K9
WP_013679015.1.87035 gi|327310094|ref|YP_004336991.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]