SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2L3Z1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2L3Z1
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily RNA polymerase subunit RPB10 1.12e-26
Family RNA polymerase subunit RPB10 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F2L3Z1
Sequence length 65
Comment (tr|F2L3Z1|F2L3Z1_THEU7) DNA-directed RNA polymerase subunit N {ECO:0000256|HAMAP-Rule:MF_00250} KW=Complete proteome OX=999630 OS=Thermoproteus uzoniensis (strain 768-20). GN=TUZN_1843 OC=Thermoproteaceae; Thermoproteus.
Sequence
MMAPIRCFTCGRPLGHLWEPFKRRVLAGEDPGKVLDELGVTRYCCRRTLLAHVDWIDDVL
KFEAR
Download sequence
Identical sequences F2L3Z1
WP_013680638.1.87035 gi|327311718|ref|YP_004338615.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]