SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2T8U0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F2T8U0
Domain Number - Region: 60-85
Classification Level Classification E-value
Superfamily Neurophysin II 0.0628
Family Neurophysin II 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F2T8U0
Sequence length 108
Comment (tr|F2T8U0|F2T8U0_AJEDA) Uncharacterized protein {ECO:0000313|EMBL:EGE79653.1} KW=Complete proteome OX=653446 OS=dermatitidis). GN=BDDG_02594 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Blastomyces.
Sequence
MKLLALTLTLFGTSMLAPVVMGAAIDTGPGLNAGPNAPSSAPPNAPPNALPDEDGPHPPR
RDWCAPGLVCYTDWDCRRDQDCSRRVSDLSQIFCGTFFYPRSCWYRKG
Download sequence
Identical sequences F2T8U0 T5BWS4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]