SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F3BL50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F3BL50
Domain Number - Region: 16-83
Classification Level Classification E-value
Superfamily Taf5 N-terminal domain-like 0.0902
Family Taf5 N-terminal domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F3BL50
Sequence length 138
Comment (tr|F3BL50|F3BL50_PSEHA) Uncharacterized protein {ECO:0000313|EMBL:EGI72670.1} KW=Complete proteome OX=722419 OS=Pseudoalteromonas haloplanktis ANT/505. GN=PH505_bg00290 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MSNQELFSNNPLQGVKLEQVVEELVEQYGWELLHAYLQLNCFKNNPDIKSAVKFLRKTQW
AQEKVDNFYLYRLKNLPRPDDVQYELPPRDRVIPADHKPGEPCELSFSDAKRIMEKKASK
QRARDRKQRSNSSNPWGN
Download sequence
Identical sequences A0A0B2JBT2 F3BL50 G7G327
WP_002960902.1.34604 WP_002960902.1.41085 WP_002960902.1.63420 WP_002960902.1.65950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]