SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F3H906 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F3H906
Domain Number - Region: 103-176
Classification Level Classification E-value
Superfamily Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.0262
Family Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.01
Further Details:      
 
Domain Number - Region: 19-55
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0745
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F3H906
Sequence length 193
Comment (tr|F3H906|F3H906_PSESX) Chemotaxis sensory transducer {ECO:0000313|EMBL:EGH55819.1} KW=Complete proteome OX=629264 OS=Pseudomonas syringae Cit 7. GN=PSYCIT7_30387 OC=Pseudomonadaceae; Pseudomonas; Pseudomonas syringae.
Sequence
MMSNQFSSTPAQRHPRFIWFSLIPVVPAIAWILSQFGMGTANLVACAALLVIGFGACAWS
ARSQQNEVRHAVAQALDHHQAHSAQSSAMASSAQFNEILLGAMPIWAKQVESSRQQTETA
IVELSTRFMGISERLQETVQASQHAAGELDGQNADGALKVLSQSDSELSRVIDSLKSTQA
SRDQTLSQVRSLT
Download sequence
Identical sequences F3H906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]