SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4LRW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F4LRW7
Domain Number - Region: 32-73
Classification Level Classification E-value
Superfamily Hypothetical protein c14orf129, hspc210 0.0209
Family Hypothetical protein c14orf129, hspc210 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4LRW7
Sequence length 81
Comment (tr|F4LRW7|F4LRW7_TEPAE) Uncharacterized protein {ECO:0000313|EMBL:CDI40965.1} KW=Complete proteome; Reference proteome OX=1209989 OS=Tepidanaerobacter acetatoxydans (strain DSM 21804 / JCM 16047 / Re1). GN=TEPIRE1_2352 OC=Thermoanaerobacteraceae; Tepidanaerobacter.
Sequence
MAKSQKRVRKKMHTNSKSNDDRNAVGKKVDNTIEDRLTDDTMYGEIIPSLMGWISPENQE
QRTNRLMEISEEITALKKKRK
Download sequence
Identical sequences F4LRW7
gi|332800114|ref|YP_004461613.1| WP_013779225.1.59919 WP_013779225.1.8343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]