SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F4WMR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4WMR3
Domain Number 1 Region: 24-109
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 1.44e-27
Family Chemosensory protein Csp2 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F4WMR3
Sequence length 120
Comment (tr|F4WMR3|F4WMR3_ACREC) Putative odorant-binding protein A10 {ECO:0000313|EMBL:EGI64540.1} KW=Complete proteome; Reference proteome OX=103372 OS=octospinosus echinatior). GN=G5I_07047 OC=Vespoidea; Formicidae; Myrmicinae; Acromyrmex.
Sequence
MARFSYFMTIISIALLCVSAEELYSDRYDQIDAEDILQNDKLRDQYYNCFMETAPCVTAD
AKFFKGVMSEIIQTNCKKCTEKQKEMFTETKNWFTQNKPEQWEALVAKSAEDMKKKNAGL
Download sequence
Identical sequences F4WMR3
Aech_07908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]