SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F5LNZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F5LNZ6
Domain Number - Region: 84-130
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 0.0497
Family N-terminal domain of cbl (N-cbl) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F5LNZ6
Sequence length 151
Comment (tr|F5LNZ6|F5LNZ6_9BACL) Uncharacterized protein {ECO:0000313|EMBL:EGL15870.1} KW=Complete proteome; Reference proteome OX=944559 OS=Paenibacillus sp. HGF7. GN=HMPREF9413_3471 OC=Paenibacillus.
Sequence
MSDKDIVRLIFDDRKDVEAILGDPEAFDVHECILNYGLSTKKFLYVDYKGEDDREIVNYI
LDYEFARNIELALQEELEELGEFEYELLPDKIKEANKIISKRGYGLFSYPTSGDFYALFI
AKLENKTKLLQVDLLHDERIPSKERYVQYYF
Download sequence
Identical sequences F5LNZ6
WP_009675687.1.20887 WP_009675687.1.25356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]