SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F5SBS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F5SBS7
Domain Number - Region: 43-94
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 0.0106
Family A middle domain of Talin 1 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F5SBS7
Sequence length 161
Comment (tr|F5SBS7|F5SBS7_9BACL) IS605 family transposase {ECO:0000313|EMBL:EGK13858.1} KW=Complete proteome; Reference proteome OX=997346 OS=Desmospora sp. 8437. GN=HMPREF9374_0558 OC=Desmospora.
Sequence
MHKAYKFRLYPTPKQATLIHKSMGCSRFVFNQFLAKWNENYTNTGKGLTYHTCSSQLTQM
KKEIDWLNEVDATSLQNSLKNLADAFSRFFKKQNEKPRFKSRRNRVQSYTSQCNYPKGRK
PTIEVAGNRIKLPKLGWVKFAKSREVEGRILSATIRRNPSG
Download sequence
Identical sequences F5SBS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]