SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6GWD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F6GWD5
Domain Number - Region: 252-333
Classification Level Classification E-value
Superfamily Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.00667
Family Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6GWD5
Sequence length 356
Comment (tr|F6GWD5|F6GWD5_VITVI) Uncharacterized protein {ECO:0000313|EMBL:CCB44298.1} KW=Complete proteome; Reference proteome OX=29760 OS=Vitis vinifera (Grape). GN=VIT_05s0029g00630 OC=Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
Sequence
MRHQYLLVKQKIKKPELGDAASGPEDFNWVEGITHWSNFLRYKEVFGDVPLAFNGIEPLA
MVGNDENGGGFIGSNRGMEIVEFGHLGHSADGDFGVENGVLGMGFEYDGDDGEENYNNGN
NRVREDGDDGFVYEEVDPSASSSRKKRKALKGLEKKAWGFLSNQLGQLREMEARFEHREA
EREREKQRRETLGMELEKEVERKLEEREKEREERDKAREELRRQWIREWELMEKESEDRE
RRRREEELIEEREWEERMNRRRTEWKKRIDEMLSQHRAEMGQIQSRILHEQQNLSSQLLG
IISQWSGHPTGLSDHTGASNHYLSQMMQNLHHVNGIVHGDARVEGDNQDDQFIVDG
Download sequence
Identical sequences F6GWD5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]