SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6PV70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F6PV70
Domain Number - Region: 25-55
Classification Level Classification E-value
Superfamily Defensin-like 0.000275
Family Defensin 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6PV70
Sequence length 65
Comment (tr|F6PV70|F6PV70_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000021316} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=LOC108587923 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MRKFLFLFAVFFFLTPGKNAVFDERCHRLKGTCVGYCKKNEEIIALCQKSLKCCLTIQPC
GKIRE
Download sequence
Identical sequences F6PV70
ENSCJAP00000021316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]