SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6R0L6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6R0L6
Domain Number 1 Region: 94-160
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 8.64e-17
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6R0L6
Sequence length 181
Comment (tr|F6R0L6|F6R0L6_CALJA) Achaete-scute family bHLH transcription factor 3 {ECO:0000313|Ensembl:ENSCJAP00000021473} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=ASCL3 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MMDNRSNSSLPDKLPIFSNSACLPMSRSFYLEPTVTFHLHPEAPVPSPYSEELPLLPFPS
DSLIMGNYGEPCPFSFPMPYPNYRRCEYSYGPAFIRKRNERERQRVKCVNEGYAQLRHHL
PEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKCSSMIATTSRHADSMFRI
V
Download sequence
Identical sequences F6R0L6
XP_002755062.1.60252 ENSCJAP00000021473 ENSCJAP00000021473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]