SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6S374 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6S374
Domain Number 1 Region: 327-568
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.2e-81
Family Eukaryotic proteases 0.0000568
Further Details:      
 
Domain Number 2 Region: 104-204
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000017
Family Spermadhesin, CUB domain 0.0039
Further Details:      
 
Domain Number 3 Region: 210-248
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000034
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 2-85
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000393
Family Spermadhesin, CUB domain 0.004
Further Details:      
 
Domain Number 5 Region: 287-326
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 246-282
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000327
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6S374
Sequence length 572
Comment (tr|F6S374|F6S374_HORSE) Transmembrane protease, serine 7 {ECO:0000313|Ensembl:ENSECAP00000003189} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=TMPRSS7 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MCHFKLVAIVGYLIRFSIESIEIEADNCVTDSLTIYDALLPIRSTILYRICEPTRTLMSF
VSTNNLMLVTLKSPQIRSLSGIRAYLEVIPEQKCENTVLVKEIAGFEGKISSPYYPSYYP
PKCTCTWKFQAPLPTLGIALKFHNYSITQKSVKGCDHGWWEINEHMYCGSYMDHQTIFRV
PRPLVHVQLQCSSRLSDKPLLVEYGSYNISQPCPVASFRCSSGLCVPQAQRCDGVNDCFD
ESDELFCVSLQPACNTSSSGPRGPLVCDGFRDCEDGQDEQNCTQSIPCNNGTFKCSNDIC
LRKQNAKCDGTVDCPDGSDEEGCSCSGSSSILHRIIGGTDTQEGGWPWQVSLHFVGVAYC
GASVISREWLLSAAHCFHGNRLSDPTPWTAHLGMYVQGNAKFVSPVRRIVVHEYYNSQTF
DYDIALLQLSIAWPETLKQLIQPICIPPAGQKVRSGEKCWVTGWGRRHEADNKGSPVLQQ
AEVELVDQTLCVSTYGIITSRMLCAGVMSGKRDACRGDSGGPLSCRRKSDGKWILTGIVS
WGHGCGRPNFPGVYTRVSNFVPWIHKYVPSLL
Download sequence
Identical sequences F6S374
ENSECAP00000003189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]