SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6S4X5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6S4X5
Domain Number 1 Region: 171-375
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.5e-53
Family DBL homology domain (DH-domain) 0.00000000672
Further Details:      
 
Domain Number 2 Region: 2-236
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.03e-47
Family Calponin-homology domain, CH-domain 0.0037
Further Details:      
 
Domain Number 3 Region: 380-542
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-33
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 
Domain Number 4 Region: 633-753
Classification Level Classification E-value
Superfamily SH2 domain 2.21e-26
Family SH2 domain 0.00071
Further Details:      
 
Domain Number 5 Region: 780-839
Classification Level Classification E-value
Superfamily SH3-domain 5.78e-22
Family SH3-domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6S4X5
Sequence length 845
Comment (tr|F6S4X5|F6S4X5_CALJA) Vav guanine nucleotide exchange factor 1 {ECO:0000313|Ensembl:ENSCJAP00000030012} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=VAV1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTQI
AQNRGIVPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRS
EPVCMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLKAQDIEIIFINI
EDLLRVHTHFLKEMKEALATPGAANLYQVFIKYKERFLVYGRYCSQVESASKHLDHVAAA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQEAMEKDNLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKM
DRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQVRDDSSGDRDNKKWSHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMSISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCHRCRAPAHKECLGRVPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVF
QEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPYVH
GPPQDLSAYLWYAGPMERAGAESILTNRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKI
MTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTVSKPAVGS
TKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEED
YSEYC
Download sequence
Identical sequences F6S4X5
ENSCJAP00000030012 XP_002761688.1.60252 ENSCJAP00000030042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]