SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6SBB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6SBB8
Domain Number 1 Region: 48-143
Classification Level Classification E-value
Superfamily Fibronectin type III 5.4e-42
Family Fibronectin type III 0.00012
Further Details:      
 
Domain Number 2 Region: 152-249
Classification Level Classification E-value
Superfamily Fibronectin type III 8.53e-18
Family Fibronectin type III 0.0000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6SBB8
Sequence length 562
Comment (tr|F6SBB8|F6SBB8_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000000796} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=IL2RB OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MQPPYQMGPHSQLHPMSMTTYSPLPWYLPFFLLLFALPLIQGALKDSSQLSCFYNSRANI
SCTWSPEPTLRVEQCRIYAKSKLRTENQSCELLHVGPTFWTCNLILGEFNRQSLTAADVM
VMTVSCLMGEQRFVMEEDFEPFQRIRLMTLNDLSLNQQEEHTYNVSWNVPMCSHYLDKYL
VFEARYRIQGKPWEEAAVLSIKQDQRWVCIEKLSPDTEYEFQVRGKPERMTSAAVWSPWS
QTLVFRTKPQGSNFNYWLPHLIMGLCGTVAILLLLLLVYKWYPQKWLKKILKYHTPDPSK
FFSPLSTEHGGDFQKWLSSPFPTASFSTSILAPEISPLEVMQKEDPNLGLLLSKELVPAY
RSPETSGHSLSSCFTNQGYFFFHLPDALEVESCQVYFTYEPFNEEEEENKVEGNQGSLMP
QLHPGGPEDDSYCTFPPGDDMILFSPRLFQSPGNNLGPQSISCPGKEIKKETLPPEEHIA
TNPSCNPCFSALQNSLDLRPESVQNGSLLLGSGLGSVPPFPSADVPSAADQTRAVSSSYP
VLNTGAYLSLGELQNQYQTHSA
Download sequence
Identical sequences F6SBB8
XP_007503510.1.35504 ENSMODP00000000796 ENSMODP00000000796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]