SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6SI67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6SI67
Domain Number 1 Region: 726-796,848-1007
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.14e-58
Family Tandem AAA-ATPase domain 0.0000896
Further Details:      
 
Domain Number 2 Region: 498-724
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.23e-54
Family Tandem AAA-ATPase domain 0.0000992
Further Details:      
 
Weak hits

Sequence:  F6SI67
Domain Number - Region: 249-300
Classification Level Classification E-value
Superfamily UBA-like 0.00194
Family CUE domain 0.031
Further Details:      
 
Domain Number - Region: 397-432
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00845
Family ComEA-like 0.08
Further Details:      
 
Domain Number - Region: 27-36
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0445
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6SI67
Sequence length 1028
Comment (tr|F6SI67|F6SI67_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000024051} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=SMARCAD1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MSHFNLDRFRFEKRNKIQEQPEPAPQPPPPTPPPPPQVELPSPVSIIEDDDLERGKGSRP
GTPDSDITEKTEDSSVPETPEPERKSGVSYFRNQKGIQFIDLSSDSEDFASPNCSNINQE
EKSEREPVIIVSEQSEDEQTEEYSNMTQRNDDISELEDLKDAKLQTLKELFPQGSDSDLL
KLIESTSTMDGAIAAALLMFGEGIPRKRKLDSSSSYTSEDEDDENNQTVKRKRFHPLEEP
KDFEESEDKWDKQEAIVAKLQTEFPSLAKEELREVLKEHEWMYNEALESLRVFAEDQQDV
QYPSKSEVSNGKAVSRKSQNHLKNTPKTKLKQKCSVKAQNGFNKKGKKTFFTSKKEMPDS
EFDSGSDVGSSLDEDYSSGEEVMEDGYKGKILHFLQGASIGELTLIPQCSQKKAQKITEL
RPFNSWEALFTKMCKTNGLSEDLIWHCKTLIQERDVVIRLMNKCEDISNKLTKQVTRLTE
GGGGWNIDQPSILNQSLSLKPYQKIGLNWLALLHKHGLNGILADEMGLGKTIQAISFLAY
LYQEGNRGPHLIVVPASTLDNWIRDVNLWCSNLDVLFYYGSQEDRKQLRYDIHNKVVDFN
VIVTTYNCAISSSDDRNLFRRLKLNYAIFDEGHMLKNMGSVRYQHLMTINAKNRLLLTGT
PVQNNLLELMSLLNFVMPHMFSSSTSEIRRMFSSKAKSAEEQSIYEKERIAHAKQIIKPF
ILRRVKEEVLKQLPPKKDCVELCAMSEKQEQLYFGLFNKMKKSINGMEKSSEMGNVMMQL
RKMANHPLLHRQYYTAEKLKIMSQLMLKEPTHCEANPDLIFEDMEVMTDFELHLLCKQYA
HINDFMLDMDLILDSGKFKKLECILSELKEKGDRVVLFSQFTMMLDILEVLLKHHQHRYL
RLDGKTQISERIHLIDQFNTDMDIFIFLLSTKAGGLGINLTSANVVILHDIDCNPYNDKQ
AEDRCHRVGQTKEVHVIKLISQGTIEESMLKINQQKLKLEQDMTTTDEGDEGNVPADIAT
LLKTSLGL
Download sequence
Identical sequences F6SI67
ENSMODP00000024051 XP_007495789.1.35504 ENSMODP00000024051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]