SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6SS80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6SS80
Domain Number 1 Region: 319-448
Classification Level Classification E-value
Superfamily PH domain-like 7.87e-27
Family Ran-binding domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6SS80
Sequence length 450
Comment (tr|F6SS80|F6SS80_XENTR) Nucleoporin 50kDa {ECO:0000313|Ensembl:ENSXETP00000062350} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=nup50 OC=Silurana.
Sequence
MAKRIADKELTDRNWDQEEEAEDAGTFSVASQEVMKTREIKKAKRRNLGSDGERGGAFKG
FKGLFSGTGASLPSFGNGSSXXXXXXXXXXXXXXXSTSLFINLKPASESKPTFGSAFTSR
PLLGAADKPLGTASTNGERALSTSGAALSKAGNSEYNKHLTSLNCSVRDWIVKHVNTNPL
CDLSPIFRDYEKHLSAIEQKYGASSDSGSESDGAAQTKTIPTLHSIKADPIATFSFGSKD
KAPGVPVKTPPDSKPQAAAPTFNFGQKVDSSTLSLIGSGGAPSFSFSTGASSLFGKSTGS
TASSSQESEPSSNTEGKGDGEEEEEPPKAVIQEVKEDDAFYSKKCKLFYKKDNEFKEKGV
GTLHLKPVENKKTQLLVRADTNLGNILLNILVQPSMPCSRTGKNNVMVVCVPNPPIDEKN
PTVPATLLIRVKTAEDADELHKILLEKKEV
Download sequence
Identical sequences F6SS80
ENSXETP00000006649 ENSXETP00000062350 8364.ENSXETP00000006649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]