SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6V807 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6V807
Domain Number 1 Region: 295-600
Classification Level Classification E-value
Superfamily Kelch motif 2.48e-46
Family Kelch motif 0.00055
Further Details:      
 
Domain Number 2 Region: 12-126
Classification Level Classification E-value
Superfamily POZ domain 3.45e-31
Family BTB/POZ domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6V807
Sequence length 623
Comment (tr|F6V807|F6V807_CANLF) Kelch repeat and BTB domain containing 12 {ECO:0000313|Ensembl:ENSCAFP00000006077} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=KBTBD12 OC=Canis.
Sequence
MECKTEGKEKYQHSLNLLNQVKNMRELAEMIDVVLIAEGEKFPCHRLVLSAFSPYFKAMF
TCGLLECTQREVILYDITAESVSVILNYMYNAALEINNANVQTVAMAAYFMQMEEIFSVC
QKYMMDHMDASNCVGIYYFAKQIGAEDLSDQSKKYLYQHFAEVSLHEEILEIEAHQFLKL
IKSDDLNISREESILDLVLRWVNHNQEMRTEHLVELLKQVRLELINPSFLRQALKRNTML
LCDANCIDIIQNAFKAIKTPQQHSLNLRYGMETTSLLLCIGNNSSGIRSRHRNYGDASFC
FDPVSRKTYFVSSPKYGEGLGTVCAGVVMENNTIIVAGEASASKLSRQKNKNVEIYRYHD
RGNQFWEKLCTAEFRELYALGSVHNDLYVIGGQMKVKNQYLITNCVDKYSVERDSWRRMS
PLPLQLACHAVVTVNNKLYVIGGWTPQMDLPDEEPDRLSNRLLQYDPSQDQWTDRAPMKF
SKYRFSTAVVNSEIYVLGGIGCVGRDKGQVRKCLDVVEIYNPDGDFWREGPPMPSPLLSL
RTNSTNAGTVDGKLYVCGGFHGADRHEVISKEILELDPWENQWNVVAINVLMHDSYDVCL
VARMNPRDLIPPPSDLVEEGGEH
Download sequence
Identical sequences F6V807
XP_005632135.1.84170 ENSCAFP00000006077 ENSCAFP00000006077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]