SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6VEZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6VEZ4
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Globin-like 2.17e-52
Family Globins 0.000000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6VEZ4
Sequence length 147
Comment (tr|F6VEZ4|F6VEZ4_CALJA) Hemoglobin subunit beta {ECO:0000313|Ensembl:ENSCJAP00000037586} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=LOC100410976 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MVHLTGDEKSVVAALWSKVNVDEVGGEALGRLLVVYPWTQRFFEFFGDLSSPAAVMGNPK
VKAHGKKVLGAFSDGLAHLDNLKGTFAQLSELHCDKLHVDPENFRLLGNVLVCVLAHHFG
KEFTPVVQAAYQKVVAGVANALAHKYH
Download sequence
Identical sequences F6VEZ4
ENSCJAP00000037586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]