SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6XEZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6XEZ3
Domain Number 1 Region: 243-310
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000117
Family Splicing factor U2AF subunits 0.025
Further Details:      
 
Weak hits

Sequence:  F6XEZ3
Domain Number - Region: 309-337
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000196
Family CCCH zinc finger 0.0054
Further Details:      
 
Domain Number - Region: 175-199
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000249
Family CCCH zinc finger 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6XEZ3
Sequence length 470
Comment (tr|F6XEZ3|F6XEZ3_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000021460} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=ZRSR2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
GGILKMAAPAVLPLAEKPNHKKYRAALKKEKRRRRRQERARLRDSGLSQKDEEEEESIVE
LEEEEKQLEAERQKLHEEWLLREQKAQEEFKLKKEKEEAAKRRQEEEEADNSKSEWEQGR
KSNGQNNIETRCELPDFKEAVQKMLDQAESQLENGVTWHNPEPPVDLRATEKDQANCPFY
IKTGSCRFGDRCSRKHNYPTSSQTLLIRSMFITFGMEQCRRDDYDTDASLEYSEEETYQQ
FLDFYEDVLPEFKNVGKVIQFKVSCNFEPHLRGNVYVQYQSEEECQAAFSLFNGRWYAGR
QLQCEFSPVTRWKMAICGLFGRQKCPRGKHCNFLHVFRNPNNEFWEANRDIHMSPDWANT
SFGKSSERRDRTSYHEEYYSRSRRRRSPSPDHSYKRNGESERKKSNHHRSKKKSHKHSSK
SHERRRSRSRGRKRDRSRRSRSQSRSRRSQSKSASRSRSRDRKRSTSRDR
Download sequence
Identical sequences F6XEZ3
ENSMODP00000021460 13616.ENSMODP00000021460 ENSMODP00000021460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]