SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6YFM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YFM6
Domain Number 1 Region: 98-168
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Weak hits

Sequence:  F6YFM6
Domain Number - Region: 196-300
Classification Level Classification E-value
Superfamily LigT-like 0.00012
Family 2'-5' RNA ligase LigT 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6YFM6
Sequence length 357
Comment (tr|F6YFM6|F6YFM6_CALJA) Activating signal cointegrator 1 complex subunit 1 {ECO:0000313|Ensembl:ENSCJAP00000013561} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=ASCC1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MEVLRPQLIRIDGRNYRKNPIQEQTYQREEVEEDFYQGSMECADEPCDAYEVEQTPQGFR
STVRAPSLLYNLIHLNIANDCGFQKRTLDCYNYLHLKDRHIVGKRGDTRKKIEMETKTSI
SIPKPGQDGEIVITGQHRNGVISARTRIDVLLDTFRRKQPFTHFLSFFLNEVEVQEGFLR
FQEEVLAKCSMDHGVDSSIFQNPKKLHLTIGMLVLLSEEEIQQTCEMLQQCKEEFINDIS
GGKPLEVEMAGIEYMNDDPGMVDVLYAKVHMKDGSNRLQELVDRVLERFQASGLIVKEWN
SVKLHATVMNTLFRKDPNAEGRYNLYTPDGKYIFKERESFDGRNILKALALLEYLKW
Download sequence
Identical sequences F6YFM6
ENSCJAP00000013561 ENSCJAP00000013561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]