SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6YJT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6YJT9
Domain Number 1 Region: 128-331
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.05e-50
Family Reprolysin-like 0.00047
Further Details:      
 
Domain Number 2 Region: 421-478
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000314
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 3 Region: 958-1013
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000902
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 4 Region: 768-826
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000575
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 5 Region: 828-884
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000837
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 6 Region: 889-951
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000353
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Weak hits

Sequence:  F6YJT9
Domain Number - Region: 712-766
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000183
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6YJT9
Sequence length 1058
Comment (tr|F6YJT9|F6YJT9_MONDO) ADAM metallopeptidase with thrombospondin type 1 motif 18 {ECO:0000313|Ensembl:ENSMODP00000010041} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=ADAMTS18 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
SGLIRTQENEFLISPLPMLLAQEHNYTSPTGHHPHVLYKRTAEEKIQRYQGFPGSSLHLP
AHPQSQNPQEPPSPEKPSQHRRLQKQHFCGRRKKYAPKPPTDDTYVRVDEYVSTGRLRRS
AGKAQRGLNVETLVVADKKMVEKHGKENVTTYILTVMNMVSSLFKDGTIGSDINIVVVSL
LLLEHEPVSLQLRINYPEKLTIFLQRKSALIGKNNKRHDHAILLTGLDICSWKNEPCDTL
GFAPISGMCSKYRSCTINEDTGLGLAFTIAHESGHNFGMIHDGEGNPCRKAEGNIMSPTL
TGNNGVFSWSSCSRQYLTKFLSTAQASCLVDEPKQTGQYKYPDTLPGQIYDADVQCKWQF
GAKAKLCSLSFVKDICKSLWCHRTGHRCETKFMPAAEGTICGLSKWCRRGQCVKFGEHGP
RPIHGHWSEWSAWSECTRTCGGGVTQQERHCTNPKPQHGGKFCSGSSRLYQLCNVHPCQT
NSMDFRSQQCAEYNSKPFRGWYYKWKPYTKVEEKDRCKLYCKAENFEFFFAMSSKVKDGT
SCSPNKNDVCIDGICEPVGCDHKLGSQATLDACGVCKGDNSTCKFYKGLYLDQHKANEYY
PVVTIPVGARSIEIQELQISTSYLAVCNLNKKYYLTGDWTIDWPGEFQFAGTVFDYQRPL
NHPERLYAAGPTNETLVFEILMQGKNPGISWKYTLPKVTSTTQTVTQGHIYAWKTVQLEC
SVSCGGGYFTVKTICLQDHQKQVNSSFCSSKTKPVIEPQTCNAFSCPAYWAPGEWSSCSQ
SCGGGQQSRLIQCVQKRSFQKEEIVVHSRCPVSTPSHIQVCNTHACPPEWSPGPWSQCSK
TCGRGVKKRAIYCQSAVRGDVLPDNMCDSVPKPEVQEGCVLGRCPRNDRLQWVVSSWSEC
SASCGPGIKKRVVQCSEKGLPGKLMTFPERRCRHIKKPKIDLEEACHQGNCPIAPGPSLV
ARWYSSPWQQCTVTCGGGLQTRAVQCLQEGRPTASCLVHQKPSAVRACNTNFCPMPTKRD
EPPCVDFFSWCHLVPQHGVCNHKFYGKQCCKSCSRKNR
Download sequence
Identical sequences F6YJT9
13616.ENSMODP00000010041 ENSMODP00000010041 ENSMODP00000010041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]