SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6ZB66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F6ZB66
Domain Number - Region: 159-189
Classification Level Classification E-value
Superfamily XisI-like 0.0235
Family XisI-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6ZB66
Sequence length 272
Comment (tr|F6ZB66|F6ZB66_MONDO) Dickkopf WNT signaling pathway inhibitor 2 {ECO:0000313|Ensembl:ENSMODP00000025781} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=DKK2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MTLMMWNKESSRCLLLLAAVLMVESSQLGSSRSKLNSIKSVLGGETPTQATNRSAAVYQG
LTFGSSKKGKNLGQVGKSSKHNHQQGEAYPCSSDKECEVGRYCNSPHQGSSACLVCRRKK
KRCHRDGMCCPGTRCNNGICIPVTESILTPHIPALDGMRHRDRNHGHYSHHDLGWQNLGR
PHSKMSHIKGHEGDPCLRSSDCMEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEI
FQRCDCAKGLSCKVWKDATYSSKARLHVCQKI
Download sequence
Identical sequences F6ZB66
ENSMODP00000025781 XP_007495892.1.35504 ENSMODP00000025781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]