SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6ZMU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6ZMU8
Domain Number 1 Region: 548-801
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.28e-89
Family Eukaryotic proteases 0.0000906
Further Details:      
 
Domain Number 2 Region: 336-442
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000314
Family Spermadhesin, CUB domain 0.004
Further Details:      
 
Domain Number 3 Region: 72-161
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000157
Family SEA domain 0.0063
Further Details:      
 
Domain Number 4 Region: 521-560
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000353
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 485-516
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000131
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 6 Region: 234-318
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000236
Family Spermadhesin, CUB domain 0.007
Further Details:      
 
Domain Number 7 Region: 450-482
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000249
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6ZMU8
Sequence length 802
Comment (tr|F6ZMU8|F6ZMU8_HORSE) Transmembrane protease, serine 6 {ECO:0000313|Ensembl:ENSECAP00000009060} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=TMPRSS6 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
STRMPMAEAPQAAGGQSDGGDGEDAEPEGMFKAPEDSKRKVGDYLRLAPLWLALVVLVSV
GVLLWYFLGYRAEVTVSQVYSGSLRVLNRHFSQDLARRESSAFRSETAKAQKMLKGLITS
TRLGTYYNSSSVYSFGEGPFTCFFWFILQIPEHRRPMLSPEVVRALLVEDLLSTANSSAP
PPYRAEYELDPEGLVLLEASVKDLVALNSTLGCYRYSYVGQGQVSLKGPDQLASSCLWHL
QGPQDLMLKLRLEWKLADCRDRLAMYDVAGPLERKLITSVYGCSRQEPVVEVLASGAVMA
VVWKKGLHSYQDPFVLSVQPVAFQACEVNLTLEGRLEPQGALRTPHFPSYYSPSTHCSWH
LTVPSLEYGLALWFDAYALRRQKYGLPCTQGQWTIQNRRLCGLRTLQPYAERIPVVATAG
VTINFTSQISLTGPGVQVHYSLYNQSDPCPGEFLCSVNGLCVPACDGVKDCPNGLDERNC
VCRATFQCQEDSTCVSLSRVCDQQPDCLNGSDEEQCQEGVPCGTFTFQCEDRSCVKKPNP
QCDGQPDCRDGSDEQHCDCGLQGPSGRIVGGAVSSEGEWPWQASLQVRGRHICGGALIAD
RWVITAAHCFQEDSMASPALWTVFLGKVWQSSRWPGEVSFKVSRLVLHPYHEEDSHDYDV
ALLQLDHPVVRSAAVHPVCLPARSHFFEPGLHCWITGWGALREGGPTSNGLQKVDVQLIP
QDLCSEAYRYRVTPRMLCAGYRKGKKDACQGDSGGPLVCREPSGRWFLAGLVSWGLGCGR
PNYFGVYTRITGVIGWIQQVLT
Download sequence
Identical sequences F6ZMU8
ENSECAP00000009060 ENSECAP00000009060 9796.ENSECAP00000009060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]