SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7ABH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7ABH4
Domain Number 1 Region: 590-765
Classification Level Classification E-value
Superfamily PH domain-like 8.47e-36
Family Phosphotyrosine-binding domain (PTB) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7ABH4
Sequence length 777
Comment (tr|F7ABH4|F7ABH4_CALJA) Mitogen-activated protein kinase 8 interacting protein 2 {ECO:0000313|Ensembl:ENSCJAP00000034041} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=MAPK8IP2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
SYDSDHCEKDSLSLGRSEQPHPICSFQDDFQEFEMIDDNEEEDDEDDEEEEEDEEGDGEG
QEGGDPGSEAPAPRPLIPSPSLEEPQKHRPTTLHLTTLGTQDSLNNNGGFDLVPPASWKE
TVLCSPAQEALRELPGPLPPTDAGPGGAQSPVRPGCDCEGNQPAEPPAPGGTSPSSDPGI
EADLRSRSSGGHGGRRSSQELSSPGSDSEDAGGARLGRMISSISETELELSSDGGSSSSG
RSSHLTNSIEEASSPASEPEPEPEPEPLREPPRRPAFLPVGPDDTNSEYESGSESEPDLS
EDADSPWLLSNLVSRMISEGSSPIRCPSQCLSPAQRQPGEPVSPAGGVAQDSQDPEAATG
PGGVELVDMETLCAPPPLAPAAPRPGPAQPGPCLFLSNPTRDTITPLWAAPGRAARPGRA
CSAACSEEEDEEDDEDEEEAEDSVGPPGGRGTGPSAPRDASLVYDAVKYTLVVDEHTQLE
LVSLRRCAGLGHDSEDDSGGEASEEEAGAALLGGSQVPGDSSPDSPDLTFSKKFLNVFVN
TSRSSSENICTPFALVPTGAPQFPRATFIPRHPDELELDVDDPVLVEAEEDDFWFRGFNM
RTGERGVFPAFYAHAVPGPAKDLLGSKRSPCWVERFDVQFLGSVEVPCHQGNGILCAAMQ
KIATARKLTVHLRPPASCDLEISLRGVKLSLSGGGPEFQRCSHFFQMKNISFCGCHPRNS
CYFGFITKHPLLSRFACHVFVSQESMRPVAQSVGRAFLEYYQEHLAYACPTEDIYLE
Download sequence
Identical sequences F7ABH4
ENSCJAP00000034041 ENSCJAP00000034041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]