SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7C3Q3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7C3Q3
Domain Number 1 Region: 168-367
Classification Level Classification E-value
Superfamily E set domains 4.67e-79
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000818
Further Details:      
 
Domain Number 2 Region: 65-184
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.48e-25
Family Voltage-gated potassium channels 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7C3Q3
Sequence length 427
Comment (tr|F7C3Q3|F7C3Q3_HORSE) Potassium voltage-gated channel subfamily J member 2 {ECO:0000313|Ensembl:ENSECAP00000005908} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=KCNJ2 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN
VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFILSWLFFGCVFWLIALLHGDLDASKESK
ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM
AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG
EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG
MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD
LAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRP
LRRESEI
Download sequence
Identical sequences F7C3Q3
XP_001498662.1.31192 XP_004432760.1.5094 XP_008520547.1.77740 XP_014594555.1.31192 XP_014594560.1.31192 XP_014594561.1.31192 XP_014695151.1.49734 XP_014695152.1.49734 XP_014695153.1.49734 XP_014695154.1.49734 XP_014695155.1.49734 9796.ENSECAP00000005908 ENSECAP00000005908 ENSECAP00000005908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]