SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7DC39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DC39
Domain Number 1 Region: 213-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 298-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.13e-17
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 161-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000128
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 17-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000275
Family KRAB domain (Kruppel-associated box) 0.0037
Further Details:      
 
Domain Number 5 Region: 268-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000159
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7DC39
Sequence length 354
Comment (tr|F7DC39|F7DC39_ORNAN) Uncharacterized protein {ECO:0000313|Ensembl:ENSOANP00000002418} KW=Complete proteome; Reference proteome OX=9258 OS=Ornithorhynchus anatinus (Duckbill platypus). GN= OC=Mammalia; Monotremata; Ornithorhynchidae; Ornithorhynchus.
Sequence
PDRVARRALRDSRALLSFQGLATFKDVALCFSQEQWGHLDPSQKDFYGEYVLQEDCGIVV
SLCKGVARGAAEREAFREGAGHGDGRIDVSTLVLHLLCHSFHSFKSRGEERLVKTMATKW
NRGDVHFIFSEEAEEAGSPPGRARPPSLPESPGLPTLPPGRPHDCPHCGKGFGCHSHLER
HLRTHTGEKPYRCRDCGKSYTRGAHLARHRKTRPYSCGQCGKSFRWTSDLVRHRRTHTGE
KPFRCEVCGKHFGQKSVLTTHRRVHLEGHFLCGECGEGFDHSQAFAAHLRAHAGGGRTCR
CAQCGRSFGRRDHLVRHQRTHTGEKPYRCPTCGKGFGRGYHLLRHQRTHSEKRL
Download sequence
Identical sequences F7DC39
ENSOANP00000002418 9258.ENSOANP00000002418 ENSOANP00000002418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]