SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7DLZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DLZ8
Domain Number 1 Region: 309-438
Classification Level Classification E-value
Superfamily PH domain-like 8.36e-27
Family Ran-binding domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7DLZ8
Sequence length 440
Comment (tr|F7DLZ8|F7DLZ8_XENTR) Nucleoporin 50kDa {ECO:0000313|Ensembl:ENSXETP00000006649} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=nup50 OC=Silurana.
Sequence
MAKRIADKELTDRNWDQEEEAEDAGTFSVASQEVMKTREIKKAKRRNLGSDGERGGAFKG
FKGLFSGTGASLPSFGNGSSTSLFINLKPASESKPTFGSAFTSRPLLGAADKPLGTASTN
GERALSTSGAALSKAGNSEYNKHLTSLNCSVRDWIVKHVNTNPLCDLSPIFRDYEKHLSA
IEQKYGASSDSGSESDGAAQTKTIPTLHSIKADPIATFSFGSKDKAPGVPVKTPPDSKPQ
AAAPTFNFGQKVDSSTLSLIGSGGAPSFSFSTGASSLFGKSTGSTASSSQESEPSSNTEG
KGNNTRGSDGEEEEEPPKAVIQEVKEDDAFYSKKCKLFYKKDNEFKEKGVGTLHLKPVEN
KKTQLLVRADTNLGNILLNILVQPSMPCSRTGKNNVMVVCVPNPPIDEKNPTVPATLLIR
VKTAEDADELHKILLEKKEV
Download sequence
Identical sequences F7DLZ8
ENSXETP00000006649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]