SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7DXG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F7DXG1
Domain Number - Region: 45-90
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.00301
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7DXG1
Sequence length 103
Comment (tr|F7DXG1|F7DXG1_CALJA) c-Myc-binding protein {ECO:0000313|EMBL:JAB08462.1} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=MYCBP OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENP
EIELLRLELAEMKEKYEAIIEENKKLKAKLAQYEPPQEEKRAE
Download sequence
Identical sequences F7DXG1
ENSCJAP00000004109 ENSCJAP00000041120 ENSCJAP00000004109 ENSCJAP00000041120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]