SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7EDZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7EDZ9
Domain Number 1 Region: 5-140
Classification Level Classification E-value
Superfamily Stathmin 4.84e-57
Family Stathmin 0.00000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7EDZ9
Sequence length 150
Comment (tr|F7EDZ9|F7EDZ9_CALJA) Stathmin {ECO:0000256|RuleBase:RU004388} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN= OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MASSDIQVKELEKRASGQAFELILSPRSKESVLEFPLSPPKKKDLSLEEIQKKLEAAEER
CKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKL
ERLREKDKHIEEVRKNKESKDPAAENASAF
Download sequence
Identical sequences F7EDZ9
ENSCJAP00000018121 ENSCJAP00000018121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]