SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7EQ88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7EQ88
Domain Number 1 Region: 317-471
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-33
Family SPRY domain 0.001
Further Details:      
 
Domain Number 2 Region: 155-266
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000148
Family Fibronectin type III 0.0022
Further Details:      
 
Weak hits

Sequence:  F7EQ88
Domain Number - Region: 8-115
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000119
Family Formin homology 2 domain (FH2 domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7EQ88
Sequence length 493
Comment (tr|F7EQ88|F7EQ88_MONDO) Fibronectin type III and SPRY domain containing 1 like {ECO:0000313|Ensembl:ENSMODP00000018306} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=FSD1L OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MDSQKEALQRIITTLASKNDEIQNFIDTLNHTLKGVQANSSSILLELDEEFDGLYSILDE
MKESMTNTIKQEQARKSQELQSQLSQCNNALENSEELLEFASRSLDIKEPEEFSKAARQI
KDRVTMASAFRLSLKPKVSDNMTHLMVDFSQERQMLQTLKFLPVPKAPEIDPVECLVADN
CVTVAWRMPEEDNKIDHFTLEYRKTNFDGLPRVKDERCWELIDYIKGTDYTLSGLKFDSK
YMNFRVRACNKAVAGEYSDPITLETKALNFSLDGSSSHLNLKVDDNCVEWDPTGGKSQEN
KMKGKENKGRSGTPSPKRTSVGSRPSSIRGSRDRFTGESYTVLGDTAIESGQHYWEIRAQ
KDCKSYSVGLAYKTLGKFDQLGKTNTSWCIHVNNWLQSTFAAKHNNKAKALDVIVPERIG
VFCDFDGGQLSFYNAASKQLLYSFKTKFTQPVLPGFMIWCGGLSLSTGLQVPSAVKTLQK
HENGMSGSTSSLN
Download sequence
Identical sequences F7EQ88
ENSMODP00000018306 ENSMODP00000018306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]