SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7FUQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FUQ2
Domain Number 1 Region: 143-460
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.03e-124
Family Transglutaminase core 0.00000000444
Further Details:      
 
Domain Number 2 Region: 3-141
Classification Level Classification E-value
Superfamily E set domains 4.55e-43
Family Transglutaminase N-terminal domain 0.0000956
Further Details:      
 
Domain Number 3 Region: 494-605
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.19e-27
Family Transglutaminase, two C-terminal domains 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7FUQ2
Sequence length 625
Comment (tr|F7FUQ2|F7FUQ2_CALJA) Transglutaminase 6 {ECO:0000313|Ensembl:ENSCJAP00000039005} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=TGM6 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MAGIRVTKVDWQRLRNGAAHHTQEYPCPELVIRRGQSFSLTLELSRDPDCEETLIFTVET
GPRASEALHTKAVFQTSELDGGEGWTAAKEAQMENTLTVSLTSPPNAVIGRYLLSTRLSS
HRKHSNRRLGEFILLFNPWCAEDDVFLASEEERQEYVLNDSGIIFRGVEKHIRAQGWNYG
QFEEDILNICLSILDRSPSHQDNPATDVSCRHDPIYVTRVISAMVNSNNDQGVVQGQWQG
RYGGGTSPLHWRGSVAILQKWFKGRHKPVKYGQCWVFAGVMCTVLRCLGIATRVVSNFNS
AHDTDQNLSVDKYVDFFGRTLEDLTEDSMWNFHVWNESWFARQDLGPSYNGWQVLDATPQ
EESEGVFRCGPASVAAIREGDIHLAHDGPFVFAEVNADYITWLWHEDESRERVYSDTKKI
GRCISTKAVGSDLRVDITGLYKYPEGSRKERQVYSKAVKRLFSVEASGRRTQIRRAGGRC
LRRDDLLEPATKPSITGKFKVLEPPMLGHDLRLALCLANLTSRAQWVRVNLSGATILYTR
KPVAEILHESHTVRLGPKEEKRIPIAISYSKYKEDLTEDKKILLAAMCLVTKGEKLLVEK
DITLEDFITIKRAHPGAPGKNFSPV
Download sequence
Identical sequences F7FUQ2
XP_008993888.1.60252 ENSCJAP00000039005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]