SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7G0V4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7G0V4
Domain Number 1 Region: 27-116
Classification Level Classification E-value
Superfamily Fibronectin type III 2.22e-22
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 2 Region: 108-217
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000353
Family Fibronectin type III 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7G0V4
Sequence length 524
Comment (tr|F7G0V4|F7G0V4_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000016333} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=IFNLR1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MAKSSLWAPLLLCLLRPAPGSPELALPQNVTLLSRNFRVYLTWLPGPNYPLNVTYVVHYQ
SFENETNWKKAKHCLRIAIRECDLTCLKHLDPFLKFKGRVRAVVQGTYSLWAESKYLEYF
IDVEPAPPILTWILTEKTLIVNATNELPSCAYLMNLKYKVEFWKEGSPNKTETQVRFHEM
AVINLPPASTGRYCLRARTVYVLTTPKYSEFTKPVCFLLGTSGTQDGILALVLLVFLPII
ILIFCMCFLKKVYFQKAKMPQSLDFPGYRWPVKILELTRQESFRDLFICPKTSLEQKRPC
AGSRGPSIAPPSEMEDHETEEESKEGDSEDSDDSGTFEAYLEIAPIKSLMIRMAKTKTET
QSLESLESLTHHPQGDFSPDTSDSKNESESFWKQSGVINYLIKDPLCEDGLALPPPVFMK
KSELVEESSKGDLSSRDSLVPLGPTSPGLVFIPEEPLVSLKTLIINMDRGTQDRSEEEEE
EEEEEEEEENCLMKDTSGGNEVEGPWSEYPKRPKVSDYQHYRLH
Download sequence
Identical sequences F7G0V4
ENSMODP00000016333 XP_001365104.2.35504 ENSMODP00000016333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]