SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7G229 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7G229
Domain Number 1 Region: 148-217
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.08e-38
Family variant PHD-like domain 0.0000922
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7G229
Sequence length 217
Comment (tr|F7G229|F7G229_ORNAN) Uncharacterized protein {ECO:0000313|Ensembl:ENSOANP00000026292} KW=Complete proteome; Reference proteome OX=9258 OS=Ornithorhynchus anatinus (Duckbill platypus). GN= OC=Mammalia; Monotremata; Ornithorhynchidae; Ornithorhynchus.
Sequence
PVAAGGPPKPIPSSPTSPAPSPARIMGVLMSKRQTVEQVQKVSLAVSAFKDGLRERPSIR
RTGEPAGTRRGTVDHAVQEQQQQEEGATAAEGAAPDPQEGGSGNRAAWERLRDGRGVEPE
EFDRANRFTPPAFTRPTRELFDDQPLDICLEPLESVANDEMCEICEVWTAENLFPCRICT
RVFHDGCLHRMGYLQGDGALEMTEVAHTEIGWSCYYC
Download sequence
Identical sequences F7G229
9258.ENSOANP00000026292 ENSOANP00000026292 ENSOANP00000026292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]