SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HEH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HEH1
Domain Number 1 Region: 1-166
Classification Level Classification E-value
Superfamily EF-hand 3.41e-46
Family Calmodulin-like 0.0000000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7HEH1
Sequence length 168
Comment (tr|F7HEH1|F7HEH1_MACMU) Uncharacterized protein {ECO:0000313|EMBL:EHH23746.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_07282 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
TEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEF
SEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTVELPEEE
NTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV
Download sequence
Identical sequences A0A091F8R7 A0A091GMR1 A0A091JWR6 A0A091N8E3 A0A091RND2 A0A091SLZ0 A0A091URC8 A0A093GBD4 A0A093IT46 A0A093PK89 A0A0A0ARM2 A0A286Y292 A0A2K5HGC9 F6UG99 F7HEH1 G1MCI4 L8HRE8
ENSGGOP00000001194 ENSGGOP00000001194 ENSAMEP00000017062 9031.ENSGALP00000020720 9544.ENSMMUP00000027322 9796.ENSECAP00000020467 ENSMMUP00000027322 ENSAMEP00000017062 ENSSTOP00000020944 ENSECAP00000020467 ENSDNOP00000026476 ENSECAP00000020467 ENSGALP00000020720 ENSDORP00000012979 ENSSTOP00000020944 XP_007442850.1.37977 XP_009077668.1.14518 XP_010023139.1.70042 XP_010146412.1.22856 XP_010176902.1.17318 XP_010207883.1.23224 XP_017529746.1.32401 ENSMMUP00000027322 ENSDORP00000012979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]