SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7II18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7II18
Domain Number 1 Region: 358-551
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 82-184
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000182
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 196-275
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000282
Family Ras-binding domain, RBD 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7II18
Sequence length 1190
Comment (tr|F7II18|F7II18_CALJA) Rho GTPase-activating protein 20 isoform 1 {ECO:0000313|EMBL:JAB30982.1} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=ARHGAP20 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MEAMSPQQETLGGQPGRSSSLTGVSRLAGGSGTKKKMKTLAERRRSAPSLILDKALQKRP
TTRESPSASVDTCTFLSSFVCSNRTLLIDGRAELKRGLQRQERHLFLFNDLFVVAKIKYN
NNFKIKNKIKLTDMWTANCVDEVGEGNTNAMKSFVLGWPIVNFVATFSSSEQKDKWLSLL
QRYINLEKEKDYPKSIPLKIFAKDIGNCAYSKTITVMNSDTVNEVINMALPMLGITGSER
DYQLWVNSGKEEAPYPLIGHEYPYGIKMSHLRDTALLTPGSKDSTTPFNLQEPFLMEQLP
REMQCQFILKPSRLAAAQPLSDSGHKTFKRRRSIINWAFWRGSSTHLDNLPTSPTSPMPG
ELFGISLPNICVNDNLPKPVLDMLFFLNQKGPLTKGIFRQSANVKSCRELKEKLNSGVEV
HLDCESIFVIASVLKDFLRNIPGSIFSSDLYDHWVSVLDQGNDEEKINTVQRLLDQLPRA
NVVLLKYLFGVLHNIEQHSSSNQMTAFNLAVCVAPSILWPPTSSSPELENEFTKKVSLLI
QFLIENCCRIFGEEITSLFGEVSVRCDARENASDISCFQLNDSSYDSLENELNEDVDAPC
SDLVKKLNQGSRSMDSVLTLSDYDLDQPEVEGLLTLSDFDLTHSKDEDVQMKQPLEAKPV
NVLVYTKIPLRDHARAPSTCIPSYLSTAAANAAKSLRRHRRCSEPSIDYLDSKLSYLREF
YQKKLRKSSCDAILSQKDEDYLKQNQPLQEEGKTCFKQSLVTGTDASKKNATTQNTKKKS
LSGSEGNHVKLFPKSKPVAISVASYSPVSSQDHSKNQCFHMDTSAYSPPHTADALKGPRT
HRRCSEPNIEDQNRKLTYLRGIYSKKQHKTSCEAGVLHGEEDYLKRHKSLQMEGQKLINQ
SLVMGIEVGKSSTTNQNTEKVLPPRLNLCPRTSYSSLSSPGTSPSGSSVSSQDSAFSQIS
EHSVFTPTETSSPIDCTFQAQRKQEELSPDLSSSSHVSGMPSPSSGQACSRMAYTKKDTM
EWHSQMHSVTLHPSTWLRNGVASLKNWSLKKKAKAARPEETKIGSPKGPLEPPSHASSVS
EANSLQEKQKDLLLRAAEGLAPLQSAQMCSSSPCQDSERHCSSPFSLVESRLKLCMKSHE
EVEPGSQSSSGSLPWERASASSWTLEEVTSPDSGPTVVCDIEDRYLTKDI
Download sequence
Identical sequences F7II18
XP_009004992.1.60252 ENSCJAP00000019218 ENSCJAP00000046495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]