SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7XNH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7XNH2
Domain Number 1 Region: 28-185
Classification Level Classification E-value
Superfamily Uracil-DNA glycosylase-like 1.15e-41
Family AF0587 domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7XNH2
Sequence length 227
Comment (tr|F7XNH2|F7XNH2_METZD) Uncharacterized protein {ECO:0000313|EMBL:AEH61227.1} KW=Complete proteome; Reference proteome OX=679901 OS=(Methanohalophilus zhilinae). GN=Mzhil_1383 OC=Methanosarcinaceae; Methanosalsum.
Sequence
MSPIIPEKERSSKPMDDANIIYHPDMIRANEWILTEYQPPEREFCIFVPCSKKKPYHKSP
SHTMYDRIIFELLRPEDVHIVTFGTCGVTPRELDTEYPFMNYEFMMGRCNVAKIKRDFIK
MESERLARYLEKTRDNYKHRIAYCIGDFRTAMQKATEMVDINVEIVPAENTLSENLQPEK
RFIYGSLSRKPYLQDLSDTLSRIMGIPKRNVGIDENLSVNDTDWYLL
Download sequence
Identical sequences F7XNH2
gi|336477305|ref|YP_004616446.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]