SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F8FA19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F8FA19
Domain Number - Region: 69-141
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0155
Family Fibrinogen coiled-coil and central regions 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F8FA19
Sequence length 144
Comment (tr|F8FA19|F8FA19_PAEMK) Uncharacterized protein {ECO:0000313|EMBL:AEI45217.1} KW=Complete proteome OX=1036673 OS=Paenibacillus mucilaginosus (strain KNP414). GN=KNP414_06698 OC=Paenibacillus.
Sequence
MNTPMEPAGRPNAVRAGVPGQRRKRRTYLVLLLFWLLLVGGGAFGAKLYTDHLRRQIAAD
IAAQTDARLIQVQQQYESQIAGLRESLGGDIAKLQEKIDSVNELLAFTKDSASSKTDNSN
QLYTQLSELQKKLEALQKQLDALQ
Download sequence
Identical sequences F8FA19
gi|337750925|ref|YP_004645087.1| WP_013920361.1.16585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]