SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F8FBB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F8FBB6
Domain Number - Region: 11-64
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0294
Family Fibrinogen coiled-coil and central regions 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F8FBB6
Sequence length 232
Comment (tr|F8FBB6|F8FBB6_PAEMK) Uncharacterized protein {ECO:0000313|EMBL:AEI42083.1} KW=Complete proteome OX=1036673 OS=Paenibacillus mucilaginosus (strain KNP414). GN=KNP414_03539 OC=Paenibacillus.
Sequence
MGVFSRIKDMTKASLHELLDKVEDPIIMLNQYLRDMEEEIATAEVTVARQIASERKLKER
LEESVRLSAQAEAGAKEALKAGQEAAARQALEQKLHHEGKVTEYTDLYESAKAQAAELVQ
QLHEMKDAYYQMRNKRSELVSRAQLAKAKKQMAEVTASNVIEGGSAVKGFRRMEEKIMSL
EVEAEIARKPYVGAGYTSSVFTAAPAADAAKQQKIDDQLAQLKEKLTSEQGQ
Download sequence
Identical sequences F8FBB6 H6NBU4
gi|379718913|ref|YP_005311044.1| WP_013917240.1.16585 WP_013917240.1.63014 gi|337747791|ref|YP_004641953.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]