SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F8S6D5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F8S6D5
Domain Number - Region: 30-68
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0144
Family Moesin tail domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F8S6D5
Sequence length 73
Comment (tr|F8S6D5|F8S6D5_SAGOE) CDK5 regulatory subunit associated protein 2 {ECO:0000313|EMBL:AEI84964.1} OX=9490 OS=Saguinus oedipus (Cotton-top tamarin). GN=CDK5RAP2 OC=Platyrrhini; Cebidae; Callitrichinae; Saguinus.
Sequence
AKKSRLPILIKPSGSSGNMYHLPGTQEVVAQLQNQILELQGELKELKTCNEQLHQKLILA
EAMEEGRPXPDKT
Download sequence
Identical sequences F8S6D5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]