SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F9FJB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F9FJB7
Domain Number - Region: 121-154
Classification Level Classification E-value
Superfamily Stathmin 0.0262
Family Stathmin 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F9FJB7
Sequence length 288
Comment (tr|F9FJB7|F9FJB7_FUSOF) Uncharacterized protein {ECO:0000313|EMBL:EGU82943.1} KW=Complete proteome; Reference proteome OX=660025 OS=Fusarium oxysporum (strain Fo5176) (Fusarium vascular wilt). GN=FOXB_06496 OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MSSHYTPVGYSMPLPVPSKGSQYPTYSQYSVSPPECDDSVSSASGIPSYSNGGYSATSSG
YQYSGGYGEYESTRSASGVDFQEYMQDRFANSFDPIPLDRSMAMQAQTSGKMNAKHRELM
ELQKKAQARLAKTRERFQEGMRDAHEVRSDLEWTQKKVGEYFTLVMPPSIPTCMNYSFMQ
GEREVTLKSGSLSAAIEPPGARCLAAFKQSDKAGVWAVLSQERQPHGFWGSSCGVPGDSV
SGFAARHDVSEPIAAWETCLETSLGMGDTGAAEGCKVVLLVAFAEGVY
Download sequence
Identical sequences F9FJB7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]