SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F9G2R9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F9G2R9
Domain Number - Region: 23-63
Classification Level Classification E-value
Superfamily Neurophysin II 0.00235
Family Neurophysin II 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F9G2R9
Sequence length 82
Comment (tr|F9G2R9|F9G2R9_FUSOF) Uncharacterized protein {ECO:0000313|EMBL:EGU76500.1} KW=Complete proteome; Reference proteome OX=660025 OS=Fusarium oxysporum (strain Fo5176) (Fusarium vascular wilt). GN=FOXB_12951 OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MKFAITLAALASLAAATPLDASSSSCKPGTYSCTPDSTGWQVCDVNHKYVAAGLCPPKTS
CVFYKKSASPYCVPPGFKFPQA
Download sequence
Identical sequences F9G2R9 X0IEF9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]