SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F9H451 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F9H451
Domain Number 1 Region: 3-136
Classification Level Classification E-value
Superfamily Phage tail protein-like 2.28e-48
Family STM4215-like 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F9H451
Sequence length 155
Comment (tr|F9H451|F9H451_HAEHA) Uncharacterized protein {ECO:0000313|EMBL:EGT82549.1} KW=Complete proteome OX=1028806 OS=Haemophilus haemolyticus M21639. GN=GGE_0647 OC=Pasteurellaceae; Haemophilus.
Sequence
MSATLPILQSIRDHIEQKTTSFSIELFPDDLDRYNLTDQYGAVLVQYAGSKFESLDSTDI
IQQRRKVLIALSVIARSQHDDTGALEILDQLRLAIVGFKPTNCTACHLISEEFAGEDSGL
WQYQLIIQTETWQVETHQPQNLPKFTAARYRRKEP
Download sequence
Identical sequences F9H451
WP_005640656.1.101344 WP_005640656.1.29741 WP_005640656.1.55170 WP_005640656.1.59051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]