SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F9H5Z7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F9H5Z7
Domain Number 1 Region: 3-135
Classification Level Classification E-value
Superfamily Phage tail protein-like 6.02e-40
Family Lambda phage gpU-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F9H5Z7
Sequence length 136
Comment (tr|F9H5Z7|F9H5Z7_HAEHA) Putative phage tail like protein {ECO:0000313|EMBL:EGT81352.1} KW=Complete proteome OX=1028806 OS=Haemophilus haemolyticus M21639. GN=GGE_0500 OC=Pasteurellaceae; Haemophilus.
Sequence
MLIHKKIRHQVSDMLKSSIKGVENIYSGRPLFIDIDQEKTAIAVFLDEISCEEVDLCHHE
YTAALNIAIYLKTALGDDALDDIADKIKERLSVAISNDELSENISEMTLISYEYEQDVTN
RTWFVSNLKYQIKYED
Download sequence
Identical sequences F9H5Z7
WP_005640348.1.101344 WP_005640348.1.29741 WP_005640348.1.55170 WP_005640348.1.59051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]