SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F9H9A8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F9H9A8
Domain Number - Region: 7-41
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.00196
Family Nuclear receptor coactivator interlocking domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F9H9A8
Sequence length 75
Comment (tr|F9H9A8|F9H9A8_STRMT) Uncharacterized protein {ECO:0000313|EMBL:EGP70613.1} KW=Complete proteome OX=1008452 OS=Streptococcus mitis SK1073. GN=HMPREF9958_0164 OC=Streptococcus.
Sequence
MFTTFFKKNQDNSDVFKKLIHRLSDMSVQDLEKIDRLLDIIFTPNQGSEQLKTEATYREE
TLDDTLKEAKNQLHK
Download sequence
Identical sequences F9H9A8
WP_000495449.1.61766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]