SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F9RY83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F9RY83
Domain Number 1 Region: 1-166
Classification Level Classification E-value
Superfamily YfbU-like 1.7e-61
Family YfbU-like 0.000000927
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F9RY83
Sequence length 166
Comment (tr|F9RY83|F9RY83_9VIBR) UPF0304 protein VII00023_17859 {ECO:0000256|HAMAP-Rule:MF_00762} KW=Complete proteome OX=870968 OS=Vibrio ichthyoenteri ATCC 700023. GN=VII00023_17859 OC=Vibrionaceae; Vibrio.
Sequence
MEMTNAQRLILSNQYYLMSQMDPTNAAKYKRLQTIVERGYVMQMRELNKDFGCIEEDECR
EITDIMEMYHAMQESNNMLEEHERKEVDQRRLQFLGFDCGSECKLVHYVRFLVESEGLYP
QFDKGEHHFNAQMPMLEKYRRMLTTWRKCPRQYHLCANELKQIFNA
Download sequence
Identical sequences F9RY83
WP_006710857.1.64424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]