SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0NHX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G0NHX1
Domain Number - Region: 92-131
Classification Level Classification E-value
Superfamily Fungal immunomodulatory protein, FIP 0.0484
Family Fungal immunomodulatory protein, FIP 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0NHX1
Sequence length 141
Comment (tr|G0NHX1|G0NHX1_CAEBE) Uncharacterized protein {ECO:0000313|EMBL:EGT31544.1} KW=Complete proteome; Reference proteome OX=135651 OS=Caenorhabditis brenneri (Nematode worm). GN=CAEBREN_32551 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MKSMKFCLLNFHGLSCFMDFALSLLSTPYVFVPAMAGYPMGLLTDWGVGAAEQTYLLLSF
CAGKMVLGQLNNTLIFSCHHCDIFIFDNLAHSVDGQKRDVEKDYGVATESSNSIGITDYN
SLHGSYDANPLPCNEHILGIL
Download sequence
Identical sequences G0NHX1
CBN32551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]