SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0QCF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0QCF1
Domain Number 1 Region: 2-46
Classification Level Classification E-value
Superfamily Nop10-like SnoRNP 0.000000000484
Family Nucleolar RNA-binding protein Nop10-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0QCF1
Sequence length 48
Comment (tr|G0QCF1|G0QCF1_NANSJ) Nucleolar RNA-binding protein, Nop10p family {ECO:0000313|EMBL:EGQ39949.1} KW=Complete proteome; Reference proteome OX=889962 OS=Nanosalinarum sp. (strain J07AB56). GN=J07AB56_06770 OC=Candidatus Nanosalinarum.
Sequence
MIRKNPDTGQYTVKDAVDGTETVSTHPPKFSYPDDMAEYRRRTREDTE
Download sequence
Identical sequences G0QCF1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]