SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0VB01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0VB01
Domain Number 1 Region: 5-103
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 2.09e-29
Family Tubulin chaperone cofactor A 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0VB01
Sequence length 108
Comment (tr|G0VB01|G0VB01_NAUCC) Tubulin-specific chaperone A {ECO:0000256|RuleBase:RU364030} KW=Complete proteome; Reference proteome OX=1064592 OS=Y-12630) (Yeast) (Saccharomyces castellii). GN=NCAS_0B00400 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Naumovozyma.
Sequence
MAPTQLDIKCKALERLVKEESYYQQELKEQQQHVDTLKKDTKVDPYDLKKQVEVLEDTER
LLPTLYAKIREFKENLQQYIDSYEGEEDLHEAKIAITNADELLASHTN
Download sequence
Identical sequences G0VB01
XP_003674501.1.18554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]