SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1KEH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1KEH5
Domain Number 1 Region: 40-468
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.44e-70
Family Integrin alpha N-terminal domain 0.00000657
Further Details:      
 
Domain Number 2 Region: 779-1002
Classification Level Classification E-value
Superfamily Integrin domains 7.06e-39
Family Integrin domains 0.0018
Further Details:      
 
Domain Number 3 Region: 468-617
Classification Level Classification E-value
Superfamily Integrin domains 1.15e-27
Family Integrin domains 0.0015
Further Details:      
 
Domain Number 4 Region: 619-760
Classification Level Classification E-value
Superfamily Integrin domains 3.45e-19
Family Integrin domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1KEH5
Sequence length 1053
Comment (tr|G1KEH5|G1KEH5_ANOCA) Uncharacterized protein {ECO:0000313|Ensembl:ENSACAP00000005550} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN=itga3 OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
MALPGCQPCRTKSPLCGQKILLFLAPTWWISLLVLPCAAFNLDTKFVVLKKGKTPESFFG
LSVALHHQTKPEKYLLLSGAPRDVASEMDNTTRMGAMYACPLSASTEDCKRVDIKVLSEP
RNNIVEDMWLGVEVASQRTASGRVMACAHRYTRILWAGNEDQRRMVGKCYIRGNDLGLQE
DDEWQAYHNEMCNANTDLESTGMCQMGISGGFTHNSVYFGAPGAYNWQGTDYVLQRESWD
QKDYSYPDEKRSNSYIGYTTEASTAVLHKHSNTFIAGAPRYNHTGAVFLMLNDSGTTLEE
KLVLLGEQVGSYFGSSIALADLNNDGWKDLIIGAPYYFDRKEEKGGAVYVYMNLGGTFHS
SANLTLTGPSNSSFGLAVASIGDVDKDDFQDIAIGAPFEGSGKVYIYHSSVGGLIDKPRQ
IISGNDFVPSIPTFGYSFSGGMDVDGNSYPDLLVGTLSENLLLLRARPVINIVSKTFTVT
PNPLDPAKCTEDSCIKVQFCFSYSQSAGDPKYKETIKLNYVIKADQDRRRVYFAKTQSAV
YRGQFSMPNEKCQTLKVLLRDDVRDKLHPIAFSMNYSLAEKSRKFRLGPQSLDAFPVLNE
DQPRENHTEIQFQKECGTDNKCHSNLQVQAVYLNDQNQMLPRRNGMQILQYSRDVKKLNL
NITVTNQPTSPTNGEDAHQALLNITFPLSLLPSSVRPSGACTFNGGVLCQLGNPFKRNQQ
AELIITFEVIGISLYTQDVIIQVEPSTLSQQDDLTAISAVLLVDYTIDASLRILNPWLQS
HFSGTVMGESAMKHEEDVGSPIRFHFQVTTKGESLGSLGTIMLGFEWPYEVSNGKWLLYP
TDIMVKGNEEWFCEPPGQVINHLNLSLNVHQRNHSSNLTRKKRELEASSKSEVPITLAAA
KKAKSDTSLSCSEGTSRCIWFECPLKDIGAVTDVTVRARVWNSTFIEDYHDFDRVKVMGQ
ATLFLRTNVSTINMKNGTVWYTVNIDSELSEEQPAELELWLVLVAVAAGLLLLGIIVLLL
WKCNFFKRTRYYRIMPKYHAIRIRQEERYQPAG
Download sequence
Identical sequences G1KEH5
ENSACAP00000005550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]